DPCstruct | MC17126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2S6E8 | 11-100 | YSLYIDTLKDWFAENVSEEWNELRRWAMEVLQEEANLQEIVQLVGSDALPESQRLLLEVARIIREVYLVQYAYHPVDTYCSVEKQYD… |
| A0A016V031 | 1-86 | MRALEDFYEKSYPEFIALRTKCKEILQEEEDLSEIVQLVGKASLAESDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLKN |
| U6LU34 | 120-210 | None |
| A0A645JPT9 | 2-70 | None |
| A0A843GBR2 | 3-71 | None |
| A0A5N6PPI5 | 966-1047 | None |
| A0A3M7H8L8 | 971-1058 | None |
| A0A7V0VZE7 | 377-465 | None |
| A0A7X7KQH2 | 29-117 | None |
| A0A3M0IZH7 | 103-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.