DPCstruct | MC17125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 410 ± 106 aa |
| Standard deviation of domain lengths | 106.14 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 75.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 95.86 |
| Assigned Pfam label(s) | CL0543- PF07243 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016UT35 | 60-518 | SPKNDQVSVRLVDSEDNTDELMLRCDRPKFCDHQYLFSKSLLGNPHCWPAGAIATIAAPIYLIIMVMISAFYAVSKLRGRISKRGAL… |
| A0A368GPT0 | 3-252 | QVCKTQLSEILKINLFKREACFKLTRNQTTIHEIRASWKDLILTCEKETDYFTRDTDHNVIDSKRCPHMGSCVSNKCAAVNSSSIIP… |
| A0A0K0EKJ2 | 29-387 | None |
| A0A368FEQ3 | 188-581 | None |
| A0A368FAW4 | 634-919 | None |
| A0A183H6F2 | 11-326 | None |
| A0A6V7YC80 | 66-552 | None |
| G0MLE2 | 5-426 | None |
| A0A6V7W056 | 73-465 | None |
| A0A0D6LZC9 | 48-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.