DPCstruct | MC17124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Standard deviation of domain lengths | 25.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SQF4 | 411-545 | YGARVQPEYLKVKKIIKKVYADRCGEVRRLRFNQQQRITFEENVEKIFDEEAKQHEVTDIRKTALILIENCTAWLYLHRSQNNHHLK… |
| A0A016UMQ6 | 10-149 | AGMKYCDECGIRTRGVLEPKRLIRKDVANICVEARNQRFKAPNREDFERNVAKLFALKAEQNKVNDLRNTVFFLVENCTAWLYLDGS… |
| A0A0B1SSV5 | 2-167 | None |
| A0A0B1TK39 | 346-512 | None |
| A0A158R3F1 | 79-264 | None |
| A0A0D8XBU8 | 130-320 | None |
| A0A0B1SXC5 | 4-193 | None |
| A0A0N4XL51 | 142-268 | None |
| A0A1I7XM87 | 536-700 | None |
| A0A0N4YNV1 | 236-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.