DPCstruct | MC17118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 132 ± 26 aa |
| Standard deviation of domain lengths | 25.89 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6BH12 | 4-104 | EVMKVGIFKGSSYVITRTDDILYSWYCGYVEVPKNHIYFEQHFDNIEDIDCHGGLTYSGYRFEDGIYYIGFDTAHFDSEPMNNLTFV… |
| A0A3S1CI92 | 13-148 | ADGEWQQEPDRIEWVFLGFPCLILRHEGSWLCGYVGIPPTHPYYGKDMLDIEIKALQVHKKITFSEASHHGDDPRAVCHQLLPKTDD… |
| A0A498GZ20 | 1-111 | None |
| A0A0Q4J7U0 | 28-185 | None |
| A0A134AEI7 | 9-125 | None |
| A0A1Y6C9W6 | 59-196 | None |
| A0A5R8Q7I1 | 8-123 | None |
| A0A0F9NUA2 | 3-135 | None |
| A0A2K9BU52 | 117-239 | None |
| A0A1V6BUA6 | 15-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.