DPCstruct | MC17115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 3 aa |
| Standard deviation of domain lengths | 3.35 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z1UEG1 | 2-77 | SEKIEEIDDFQSMSEFNRFEEWVEKEIALGSAMEINVSNYYAGINFKERWFKFNETGEIWRLVYPDGPFNGYWGPV |
| A0A4Q7KN27 | 113-183 | EFEPINGFAGRSEFRRFQQWITDRLADGTLTEVPVTSPYGQFDERWFRTSDGQTWRWVWQDGPFNGLFARV |
| A0A536HLX0 | 5-84 | None |
| A0A374FV62 | 109-184 | None |
| A0A0R3N3X1 | 21-99 | None |
| A0A085W051 | 16-84 | None |
| A0A845HRC4 | 11-86 | None |
| A0A4Q7L8M0 | 86-163 | None |
| A0A4Q7HV67 | 2-81 | None |
| A0A2N4X6L7 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.