DPCstruct | MC17113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 200 ± 32 aa |
| Standard deviation of domain lengths | 32.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9NB34 | 1-215 | MNIRKITSLTMLISFVLCILTSAILYIAPHGRVAYWSNWRLWGLSKTQWSELHLNLGILFLLAGFLHVYYNWKSITAYLKNKAKRIK… |
| A0A238Y1M5 | 9-222 | RKWIDLILFYSFLVLLISSIVLFIVPYGRVANWTGWKFFSLTKTQWENVHLISGIIFIIFLIWHIVLNWTPLQKYLLKKESIISLIV… |
| A0A6V8M165 | 1-225 | None |
| A0A7L9WI06 | 37-216 | None |
| A0A357YWF4 | 1-193 | None |
| A0A6N6VI82 | 2-173 | None |
| A0A7V4HV77 | 3-220 | None |
| A0A0S8GXA3 | 7-258 | None |
| A0A660UTY4 | 242-475 | None |
| A0A660V056 | 1-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.