DPCstruct | MC17112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6DAW3 | 2-59 | HILVVNGPNMNMLGIRQPEIYGHETYEDLKALIRAEADRLGASVSFFQSNHEGALVDE |
| Q9X658 | 42-109 | MNGPNLGILGRRQPEIYGTDTLADIEGRVAEEVTETRLEIEAFQHDGEAEMLRTIQADHDTACAIINP |
| A0A3R8PKM2 | 2-59 | None |
| A0A257XWY0 | 19-92 | None |
| M9ME92 | 16-86 | None |
| A0A4S2UDJ7 | 9-62 | None |
| A0A4Q3H1B9 | 3-67 | None |
| W8YZ60 | 186-255 | None |
| A0A0G1YWI4 | 2-74 | None |
| A0A839SR35 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.