DPCstruct | MC17111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 194 ± 29 aa |
| Standard deviation of domain lengths | 29.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1TBJ4 | 42-255 | AAATQPGEMVRDFAPGVQVVLGKRVILTGSVIMDQGPVDGLEVLACLASGKTHEAIVRLAAPDGHTARAAFTAALGLEKEGVPAPES… |
| A0A2A2RXD4 | 2-178 | KLNMTNGPIEYLLVTTAGKTHESLLTTDIEPQHLQVAMLLLGAKGMQAAPLTNAPAGGPITQALGGRNPPLPGDAVSVEVSWKQGGR… |
| A0A4P5Y435 | 24-218 | None |
| A0A7X7J3X9 | 39-245 | None |
| A0A286RE36 | 176-366 | None |
| A0A851GR69 | 113-291 | None |
| A0A7V2UWM5 | 86-289 | None |
| A0A800M9Z2 | 31-232 | None |
| A0A2A4RRL5 | 21-222 | None |
| A0A353F7E8 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.