DPCstruct | MC17110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9QZ76 | 143-290 | KSLDETSDTDTDILIEQIRTRLERDEKIQAVKDARDATGMSLKEAKEFVDMVEAESHEDRAASKDMHRQVAQYLQAGQMIQAVKYVR… |
| A0A2A2RE47 | 1-111 | MTPAQHQAILVEVRGGNKIAAIKLCREATGMGLAEAKEWVEKLEASPEAVPPAVEVAGALAPIAELLFKGEKISAIKLYREQVEPGS… |
| A0A1H0PWP9 | 70-174 | None |
| A0A497A075 | 5-101 | None |
| A0A7W5V1Y7 | 37-153 | None |
| A0A6M0RJH8 | 85-213 | None |
| A0A810L486 | 102-213 | None |
| A0A2E0L6V7 | 6-118 | None |
| A0A1C4ZH47 | 19-159 | None |
| A0A1H5MUX9 | 40-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.