DPCstruct | MC17108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1177 |
|---|---|
| Mean domain length (aa) | 145 ± 39 aa |
| Standard deviation of domain lengths | 39.02 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 75.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.01 |
| Pfam Score | 97.81 |
| Assigned Pfam label(s) | PF07486- CL0125- CL0187- CL0244- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7YZY6 | 13-116 | DLKFFVMPVDADVSDIAKKFGISEKRLMKYNELESSKLAKNDIIFLEGKNSSGNKDTYKAGIGETMHDIAQKFGIKEKKLYAKNRME… |
| A0A415Y5M9 | 3-134 | IIVYTVNKGDTLHNIAEKFGSSVNAIARANGIVAPFKIYPDQSLRIPVFEEPNFITYTVQPGDTLYSLAEYFGTTVGELANANELED… |
| A0A2B7XFV4 | 213-387 | None |
| A0A4S8MPN6 | 11-135 | None |
| A0A1L9VV34 | 75-196 | None |
| A0A1L9V3P3 | 88-209 | None |
| A0A4S9JTH6 | 228-476 | None |
| A0A496Q1K3 | 87-223 | None |
| A0A3L7PQY3 | 143-289 | None |
| A0A167LKF7 | 33-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.