DPCstruct | MC17106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 44.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H6R896 | 2-62 | YATRETATAYVIAALEAKGTATRYDFDVPAIVTASHAAARSWDFRSLEGRTFWRIAAQFLK |
| A0A2S6A097 | 1-60 | MFTMETATKYVTGLIESTGAALATDFDVPAIVDTLHRLVEDWDFDIIDRRTFWAVVATHI |
| A0A846W931 | 27-95 | None |
| K0EX41 | 57-138 | None |
| A0A164K1E8 | 3-62 | None |
| A0A7X6RFG7 | 7-77 | None |
| A0A7W9PKI3 | 3-71 | None |
| A0A366CW40 | 3-62 | None |
| A0A379C0U4 | 53-123 | None |
| A0A4R6P6Y1 | 11-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.