DPCstruct | MC17104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 166 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.08 |
| Pfam Score | 90.93 |
| Assigned Pfam label(s) | PF13867- PF13866 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3TUS5 | 1-178 | PSRTSLSEGDRSGPPAGDAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKR… |
| A0A0C2GXL5 | 30-158 | QSGERCCVAVKFLCGWMRCNRKRSQRVLNAHLERLTLLKKLNVAICDEDPHMGICLFHWRLINYGKPGVALTNEELNSWEADETRLE… |
| A0A3P3Y6M5 | 2-174 | None |
| R1EXT7 | 1-123 | None |
| A0A7R8CQD6 | 120-266 | None |
| U3I672 | 31-188 | None |
| A0A2K5X6V3 | 221-420 | None |
| A0A1S3FS73 | 57-267 | None |
| A0A835P268 | 35-217 | None |
| V8NM52 | 224-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.