DPCstruct | MC17103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0TAQ0 | 22-133 | GYLVCDNCGGFYELQPGEKIEDFNCNCDCGGTLKYFKQNPYPPNNITEQEPTSTLAYVGYVSIIFFALASIVIGIILYRRGGNDKQH… |
| A0A7L4P4V6 | 1-97 | MGYLVCEKCHSKYRLKPGELPSDFSVCSCGGKLQYVKDLNSSKPSSSGLNFRAFGYKLSRNKMLFAGVSLVLLFIVVGLALAFLDHG… |
| A0A2I0PS68 | 1-144 | None |
| A0A1D2W714 | 1-124 | None |
| A0A6N8BUN6 | 1-109 | None |
| A0A3A5HCW6 | 41-165 | None |
| A0A1V4YQC3 | 1-127 | None |
| K6T1J9 | 1-89 | None |
| A0A2A2H808 | 1-96 | None |
| F0T809 | 22-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.