DPCstruct | MC17101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 69 ± 3 aa |
| Standard deviation of domain lengths | 2.62 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831Y4S5 | 375-443 | AEALRRATAYAEAGADMILMHSKAPTAAEVLDFMRRWDGRAPVVVVPTLYPSVRWEELEAAGVKLVIWA |
| A0A7T8FUR5 | 1-63 | MLRRIYEAAEADAILIHSKMKDINEIKKFAELFKGTVPIVIVPTTYPNVTVKNLEIMGVDMVI |
| A0A7X6QCD5 | 554-625 | None |
| A0A1H6DXH6 | 140-208 | None |
| A0A821NMV4 | 226-294 | None |
| A0A0G1U2F3 | 1-72 | None |
| A0A2A5K1B4 | 71-139 | None |
| A0A1G1JIT3 | 33-101 | None |
| A0A0G0TXI4 | 323-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.