DPCstruct | MC17100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1209 |
|---|---|
| Mean domain length (aa) | 186 ± 37 aa |
| Standard deviation of domain lengths | 37.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.54 |
| Pfam Score | 96.59 |
| Assigned Pfam label(s) | PF00649- CL0020- CL0093- PF08719- CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QEY7 | 421-634 | LLQDARPAFCRLQPGSERWLQKVCDEAAMVTQSKLGAGVQAPGDDPAHAFAIVCYTLDMDQFGAAKGENFFAVYNKILQERNSELLE… |
| A0A814ZLZ7 | 17-181 | EEAINPIVSFVPDVEQMVWFDKQNCSDPKDGLTNDESASIMLYTMEWEPYEKSFYKLPSTRHVVYRGIKSNLTAQYVRGSRLVWWGF… |
| A0A818ZBJ1 | 34-236 | None |
| A0A819V0P2 | 7-131 | None |
| A0A819UF14 | 14-202 | None |
| A0A819SLM4 | 17-243 | None |
| A0A3M3TMQ3 | 367-561 | None |
| A0A7H8YWI0 | 28-224 | None |
| A0A813X6U5 | 7-162 | None |
| A0A818ZUL5 | 15-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.