DPCstruct | MC171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3I7W3 | 1-111 | MKKIIAASLIVGVLFAAAILISVRASADTPVDTSQKVVPIISLGSGLRVGAALVAGEDKQVEKVKAVAQLEGEIGAHLRIRALVPVE… |
| A0A522PLH5 | 1-106 | MAVKAVAAPLNNFINNLMAANHVANRDHTKVVPIVTVGSNTYVGAAQVSGPTYNVNRVQAVGAFKGDWNNGVWSVNALIPIDNLNVL… |
| A0A7C6LG97 | 51-153 | None |
| A0A847M5E0 | 171-264 | None |
| A0A7C3VRS4 | 42-141 | None |
| A0A1G6MAA7 | 91-196 | None |
| A0A3C0CXL5 | 147-237 | None |
| A0A2M7KPX4 | 186-272 | None |
| A0A2M7KLW7 | 37-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.