DPCstruct | MC17098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 208 ± 20 aa |
| Standard deviation of domain lengths | 19.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9EQC4 | 84-303 | LKSLEIICSCLAGVSAALPPLDGKLIPLIESPVKVYPFQFVAAPSYVKEMTYKGTNVRDFVLKRVKSVAEYLVLNRENDTKSLSAVC… |
| A0A814LZC0 | 7-191 | LRSLTIIYYTSMGCLNMILPIDDDQHLQDIVSSVVSYDVKYPFYHNKSKNLRMRLIIDIGNLLDILIENNSDNVNSIKLALKIYSLS… |
| A0A368FD75 | 1-230 | None |
| J9EMP4 | 162-372 | None |
| A0A0D8XVU6 | 42-260 | None |
| A0A819N5H1 | 208-422 | None |
| A0A819LJJ1 | 512-730 | None |
| A0A0R3Q878 | 113-307 | None |
| A0A0M3IUZ5 | 99-325 | None |
| A0A4W5RTN2 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.