DPCstruct | MC17097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 322 ± 53 aa |
| Standard deviation of domain lengths | 52.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 94.95 |
| Assigned Pfam label(s) | CL0123- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7Q7W7 | 3-274 | RKLVTLINCQLMEEEGRSRAMRAARSLGERTVTELILQHQNPQQLSANLWAAVRARGCQFLGPAMQEEVLKLVLLALEDGSALSRKV… |
| A0A814I1B7 | 14-393 | EFLRCAACSQNFEYENPLYHPITLPKCGHTMCKQCINIMGGQKECPQDQVSFGNTPIDQLPTNYPFLMMIYRSSEGQCRSYMEFDDQ… |
| A0A7R8WIH6 | 1-265 | None |
| A0A6L5D298 | 98-431 | None |
| A0A0K0DX78 | 292-621 | None |
| A0A819QWK5 | 1-339 | None |
| A0A132A6X2 | 9-233 | None |
| A0A1A8EEA3 | 4-305 | None |
| A0A818CI51 | 2-257 | None |
| A0A0N5AMT4 | 10-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.