DPCstruct | MC17090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Standard deviation of domain lengths | 13.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.93 |
| Pfam Score | 97.46 |
| Assigned Pfam label(s) | PF04446- PF14413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FMZ6 | 4-95 | SKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFSEKHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKSNWFK… |
| L8N126 | 6-98 | LDTKLRVFETAHDLCVLSGIFMVARIDGRNFTRLTKEIHKFETPFDAQFRDYMVSTVKHLMDCGFRVIYGYTQSDEISLLLHRDEES… |
| A0A1T3P8D4 | 220-333 | None |
| A0A654HHB8 | 428-522 | None |
| A0A3D3LGS6 | 9-114 | None |
| A0A5J5VRG7 | 249-359 | None |
| A0A0A9EKD8 | 1-94 | None |
| A0A1D2N1Q3 | 214-306 | None |
| A0A814H928 | 334-430 | None |
| A0A6S7NRL2 | 42-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.