DPCstruct | MC17088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 3.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 67.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2CTV5 | 62-122 | RDGSEVCLQLVSRTFCARGGEVREVKLELERARLEPYEGKLREVYRPKGLFAFTAAAKEYV |
| A0A101X5Z8 | 12-75 | AKDGSEACISLNQLKAYCARDGAVREAKLEFSGLEVYEKEIRRAYRPKGLLASTTTAKEYVRIL |
| A0A831YI29 | 30-91 | None |
| A0A832DSU4 | 1-60 | None |
| A0A832DSA9 | 5-77 | None |
| A0A832DB59 | 1-67 | None |
| A0A831YGX0 | 78-143 | None |
| A0A832DT66 | 134-195 | None |
| A0A0K1E4E3 | 156-217 | None |
| A0A831V0H8 | 240-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.