DPCstruct | MC17085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 150 ± 26 aa |
| Standard deviation of domain lengths | 26.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5ZYM9 | 457-626 | IKPDSTWKVKLRHTMERDDSSISWTLYDGNGFEAGKGMKAGHKSKELSDVIASQYRPAEDSMSYVVDLKVIESLRLELTQTELIIQK… |
| A0A6A6H808 | 168-317 | VNPPPQSPPPPPPPPSYATGTCCFHLDEWEDCNPESDDLYANVTLLDNNKATIYQTSTDAAHADWGEPINAGNGSTIQGPLPYPIQI… |
| A0A6G1J4Z0 | 575-717 | None |
| A0A6G1IF18 | 927-1098 | None |
| A0A1V6S963 | 2-135 | None |
| A0A6A5UXC1 | 336-482 | None |
| E4ZYG4 | 56-173 | None |
| A0A179H4N5 | 206-333 | None |
| B8MQY4 | 5-122 | None |
| A0A1Q5UEA1 | 214-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.