DPCstruct | MC17082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 190 ± 30 aa |
| Standard deviation of domain lengths | 29.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.95 |
| Pfam Score | 97.33 |
| Assigned Pfam label(s) | PF10197- PF15075- PF12542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0SUD1 | 1-152 | MGGGDLNLKKSWHPQTMRNQERIWKEEQKALEEQRKLQQLQKELAEERAKQELVELQEKAGLVKRSNRIEWMYAVPAGAGGQLSSEK… |
| A0A6A6GWY5 | 1-193 | MGGDLNLKKSWHPHLMTNQRKVWEQENKALDERKKIDALKKERDEERQIEEIRAMEEAAGGKTRNRRVEWMYSGPAAGDKGTSEEME… |
| G0V5A6 | 1-157 | None |
| A0A512UCX5 | 1-252 | None |
| A0A367LEE3 | 115-321 | None |
| A0A0F4YG75 | 8-169 | None |
| A0A444CD48 | 1-152 | None |
| G4ZNZ1 | 1-236 | None |
| M0ZW26 | 1-202 | None |
| A0A7M5X1M6 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.