DPCstruct | MC17081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6GWP1 | 8-144 | ETVLMVGSVPLKSSKEVFKEVCRVLSGRLHTIPDGETGDRWNYIGWQLTRFPSAARRMELGGTHLPDTGKRNYTLDSIQPTSYDEAA… |
| A0A7J9XMS4 | 5-156 | AAVLLVGSVPLTSTEEVLHACGDGLGDLAVGVPDGEVGDRSLWVIFQAYRIFHEHPQLETIQRPAPDYNWRPAGLHDIWQFRMREGV… |
| A0A2P2GY80 | 23-152 | None |
| A0A1V8URE2 | 1-130 | None |
| A0A1Y6L8M7 | 17-210 | None |
| R1GF09 | 1-149 | None |
| A0A2D5SJL6 | 1-147 | None |
| A0A840IQ51 | 242-420 | None |
| A0A5N5D966 | 215-353 | None |
| A0A094EME7 | 379-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.