DPCstruct | MC17080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 175 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4LIW3 | 67-206 | MDPDCAICHAPATMACDCEAKGLEVAIKQAENRMMQSIYSDIRSWVRGRAQDYILEYYRLLTDRRKTQHNMNLERITAHASYYYQQQ… |
| A0A6A6GVX5 | 4-170 | NPNCAICNAPALPECPCESERLTIAVRQAEKRAMDDRLHHIREWVIAHARAQILQSFNTVTSHRKIAHKKYLASLPFYDLYVQYAGH… |
| A0A4U0X5J3 | 14-247 | None |
| A0A3N2Q1N7 | 20-201 | None |
| A0A369GL30 | 3-194 | None |
| A0A6A6P4N9 | 46-215 | None |
| A0A1B8AFQ3 | 141-322 | None |
| A0A2T6ZWT7 | 1-143 | None |
| A0A4Z1NTL8 | 3-167 | None |
| A0A364NHL8 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.