DPCstruct | MC1708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7QQA0 | 220-339 | ATAFRNQRDTIESDARLVFSDVVDEFCSVRGVASRFESWRNTDAVAYQEAYVSLCLPKVLGPLVRLKMLLWNPLQDGCLEFERAKWY… |
| A0A7R9FE20 | 1-118 | LIESDARLVFEDVVEEFCSVRSIVKRFESWRFTDSDAYKEAYVSLCLPKVLGPIIRLKLITWSPLQESVEFERHKWYDTLLLYGLKE… |
| A0A3P9M3T3 | 545-663 | None |
| A0A4Z2AXE9 | 2-118 | None |
| V4AFI7 | 155-271 | None |
| A0A7S2X239 | 49-177 | None |
| A0A6V7WL24 | 5-135 | None |
| A0A2W1BYA0 | 219-360 | None |
| A0A7E5VEA5 | 172-321 | None |
| A0A4W3I6H1 | 4-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.