DPCstruct | MC17079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9Y913 | 35-112 | PFSAALHLAIESKGWTLDRVQRALLARGIGVSLSTLSYWRRGRSRPERPDSLRAVDVLEELLDLPRESLAALLGRRRR |
| C7MQ93 | 7-82 | FSEALRSAISSSGLSLDRIQIRLQERGVPVSVTALSYWQSGKRQPERQQSLRAILALEQILDVPTGSLLSLLPPPR |
| A0A2T0M0R1 | 17-100 | None |
| A0A1V4EPA5 | 14-90 | None |
| A0A7J0CQ37 | 34-125 | None |
| A0A839QWB3 | 19-100 | None |
| A0A1H2HTA4 | 1-93 | None |
| A0A0Q7VNC8 | 8-102 | None |
| A0A7G5ZMP5 | 8-97 | None |
| A0A1G9YSJ4 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.