DPCstruct | MC17078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 315 ± 38 aa |
| Standard deviation of domain lengths | 38.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.82 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0314- PF18314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7WEV8 | 11-388 | SEQEQRALARTLLIELLAYQFAFPVQWIDTQKEFFTRDEAVERYVEVGPAKVLSTMGKKTVARNHQLQDQLRLIRRQFLSHSDDYGQ… |
| S0DL59 | 3-323 | PDVEQELAYTLLIELMAHQFAYPVRWIETQDHILGEVNAERIIEIGPSPILTNMMKRTIASRFSNSDQALNINRHLMSPDNGNPDIY… |
| Q00681 | 15-298 | None |
| Q5B7V0 | 8-331 | None |
| A0A177TRZ6 | 2-270 | None |
| A0A4Y7PD86 | 1-344 | None |
| A0A0J8R3H8 | 6-347 | None |
| A0A1Y1WKL4 | 9-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.