DPCstruct | MC17074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 150 ± 27 aa |
| Standard deviation of domain lengths | 26.66 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8EPS0 | 8-134 | VAGLTPCAESPRFQQRASAASTDQAKSRFNVYSQALCGDDGLPRLIVDGRFSHAGDFLIPGLLFLYIAGTIGWAGRSYLIAIRGSKD… |
| A0A0M3KL12 | 2-153 | ISGLTPCKESKQFAKREKQSIKKLESSLKIYAADSAPALAINATIEKTKRRFDNYAKQGLLCGADGLPHLIVSGDQRHWGEFITPGI… |
| A0A7I8JEK2 | 108-282 | None |
| G1E795 | 40-194 | None |
| A0A7D3Q561 | 20-182 | None |
| A0A6A6LN35 | 5-92 | None |
| A0A7S0HKD7 | 9-133 | None |
| A0A7I8JQ14 | 40-174 | None |
| A0A1Q9D570 | 96-295 | None |
| A0A426XKZ6 | 48-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.