DPCstruct | MC17073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 71 ± 2 aa |
| Standard deviation of domain lengths | 2.27 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 42.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524MRA1 | 1-71 | MQLAIPLDTMTTVDKLKALEEIWSDLQRTPEDVPSPAWHADVLRAREDRVREGSSQFVGWTEAKRRIREQT |
| A0A7G8EMQ2 | 1-71 | MAANLPLGQMSLEDKLEAMELLWADLSATPDQVVSPAWHRDELRRRRNQLEQGSARFQSWNDAMTDLKAEL |
| A0A351ST66 | 1-71 | None |
| Q0F1A6 | 1-66 | None |
| A0A1G9G488 | 1-68 | None |
| A0A1F9M2F9 | 1-71 | None |
| A0A7X2PMH1 | 1-71 | None |
| A0A847DMN3 | 1-75 | None |
| Q1NNW1 | 1-75 | None |
| A0A148N8A0 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.