DPCstruct | MC1707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4ER30 | 200-290 | CNPCYDECSWQCKHETCRMSCSEFCKRRRCYKACQMELKCGHQCIGFCSEPCPDKCRFCDEDEVSSEYFGTEKKPNAKFVLLEDCGH… |
| A0A7R9FDX1 | 7-83 | IPQFPPVEPCLWRCEHLKCNLHCSDKCDRPPCNKPCKKDLQCGHPCIGFCGEPCPPLCRVCDREEVTAVFLGQEDEP |
| A0A7D9EL97 | 268-343 | None |
| A0A444SZU2 | 716-793 | None |
| G3NRN1 | 35-125 | None |
| A0A822HT59 | 1-93 | None |
| A0A7M7N432 | 286-360 | None |
| A0A6L2P923 | 417-504 | None |
| A0A6A0H800 | 517-596 | None |
| A0A7R9K8W9 | 158-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.