DPCstruct | MC17069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 684 ± 94 aa |
| Standard deviation of domain lengths | 93.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 72.63 |
| Assigned Pfam label(s) | PF10162- CL0268- PF13330- CL0159- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q54XG9 | 575-1301 | SPSSNITLPEGKKVLISPCSISQTQVYKWIKVPSTSELIFADSPMDFHVKDIYVEGKFIMGTTKCRYNSKINIIFHGEKTLSDTISQ… |
| A0A261GRZ8 | 194-912 | LPLWSDAETWMEGTPPEFGSEVVIPAGATVVMDNANASSVIRVSGILTTPLNRDFSLNANEVHILSGGLLELGRADAPYLGKGTVTL… |
| A0A183MTW7 | 8-537 | None |
| A0A813VGQ8 | 59-829 | None |
| A0A7V8ZH07 | 301-981 | None |
| A0A2D6E5T0 | 260-853 | None |
| A0A4V3HH68 | 66-850 | None |
| A0A7S1VAV1 | 243-801 | None |
| A0A7S1V3F9 | 4-696 | None |
| A0A858RNI4 | 25-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.