DPCstruct | MC17067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 146 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9P8X4 | 1-136 | MALVLHSLRGFPHTDIAARLPLELSVAGRLRSDMPGRFWFCRVTAEVWCRLDDSTERRHISDALLSEDGTSLRVSALVVTPAASNQV… |
| A0A0J6W854 | 1-140 | MPHLTIDSIDWDQSGGGLPYAIPELQSQLPVSGRVARQIPGPDRSDYFFVVLNPPLRFHPQPDFDWSRTQPEFHGRDDAGAFLRIYA… |
| A0A329LX28 | 1-151 | None |
| A0A064CE97 | 38-181 | None |
| A0A7Y4E3Y4 | 2-129 | None |
| A0A829PIP5 | 24-173 | None |
| A0A1P8XL49 | 3-165 | None |
| A0A1P8XKZ9 | 1-150 | None |
| A0A849F9V7 | 1-114 | None |
| G4I5W2 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.