DPCstruct | MC17064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 76.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF00124- PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328UYU7 | 1-57 | MTIAVERPQVTRGWFDVLDDWLKRDRFVFVGWSGILLFPCAYLSIGGWLTGTTFVTS |
| A0A103XB93 | 1-70 | MTITLGKVTKDENGLFDIVDDWLKRDSFIFVGWSGLFLFPCAYFAVGGWFTGTTFYTHGLASSYLEDCNF |
| A0A816ILG0 | 1-62 | None |
| Q108X8 | 1-49 | None |
| A0A540L9T2 | 1-57 | None |
| A0A6A4QG34 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.