DPCstruct | MC17063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 160 ± 24 aa |
| Standard deviation of domain lengths | 23.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18921 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1DCX9 | 2-130 | QVRAITVQTGRLVCEVAIPEQRHRQTTPRLAAFATGQYPDLPQHACVNDRGPTFGSAMEHTSVAHLLEHVAISIQTRRDDDAQRTFV… |
| A0A5M6CRD6 | 4-167 | EKIQVVNASHIWGAETKKLIQMRLNIGDLKLKSTNEIEGFSHRIKTLIPSLYSRKCQQGVTGGFFRSLDNGITIPEVVAHIAAELQT… |
| A0A2N2WFE4 | 17-171 | None |
| A0A3G4XL19 | 8-175 | None |
| C8W8R3 | 5-164 | None |
| A0A257VP89 | 59-182 | None |
| A0A1T2L4Z4 | 5-163 | None |
| A0A2K2U6P1 | 2-120 | None |
| A0A437UWT7 | 5-164 | None |
| R7CBW1 | 38-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.