DPCstruct | MC17060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 57 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9C9R4 | 3-48 | YTKPSLREGIKKKVMAGTKGGKAGQWSARKAQLVAQEYKSKGGGYS |
| A0A2E0FFG1 | 10-69 | KKKKRKSTVNQSGNYTKPALRRRIFNRIKRGGKGGAPGQWSARKAQMLAQAYKKAGGGYR |
| A0A511T3K7 | 27-98 | None |
| A0A854M945 | 40-101 | None |
| A0A1Z9SBB7 | 7-68 | None |
| A0A2E7WAM2 | 1-60 | None |
| A0A2E5AM50 | 108-170 | None |
| A0A6J4Q240 | 2-54 | None |
| A0A285R0U7 | 3-52 | None |
| A0A1V8SYU6 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.