DPCstruct | MC17056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 118 ± 4 aa |
| Standard deviation of domain lengths | 4.00 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3H1C3 | 218-333 | LTTVDRYYLAWTEYQSEHGGEPTGEQLSAYLAEKGMHGRGKRPVRPATLRRYLLPFRVYSVWAEYRLHDTQPAADTVAQECAARGIT… |
| A0A101C9F3 | 14-134 | AEEGRLTLVDRYYFAWQEYRTQHGDEPTGQKLSAYLADKGLHSRSGKPVSPSTLRRYFLSFRLYTIWAEHRESSSTPALDAIAHDCA… |
| A0A371Y739 | 4-131 | None |
| A0A499VF74 | 153-265 | None |
| A0A0U3EX44 | 1-115 | None |
| A0A7W7PYG8 | 346-460 | None |
| A0A3D9WRH2 | 484-601 | None |
| A0A1I2WGV4 | 89-204 | None |
| A0A285DNY0 | 325-441 | None |
| A0A559V1Z1 | 329-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.