DPCstruct | MC17049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 154 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9W079 | 181-327 | IFGCRSGKSNGRTLNSYLAGLFALMKPGAVMVTFERVLELGRTLSEENKGRLMRGLPESQDASFFECTWHSLGRNAVTWSYTNNVVV… |
| A0A7S2P884 | 1-157 | GVRTRTESGYALDYHLASLFAGTKPGTRMLTLDSLNEHLGDDVDLINDKLASRNPDFQRTCDATFFKYEKIELGSLQLTSWGGDCEK… |
| A0A7S0CGF5 | 69-212 | None |
| A0A7S2ET66 | 1-166 | None |
| A0A7S3ZMX8 | 315-483 | None |
| A0A7S3JV74 | 352-503 | None |
| A0A7S2JU40 | 60-217 | None |
| A0A6U5ME90 | 369-524 | None |
| A0A7S1V6N0 | 206-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.