DPCstruct | MC17048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 202 ± 18 aa |
| Standard deviation of domain lengths | 18.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0AGF8 | 15-221 | VFSLVLLLAAFYVVLFGILAGQSSLTLMFGSPVWLTVLLLSFTLLLLASLEGSQIAIVSLSDRSVEQLSEVKGKYPSAFSTLQLLGS… |
| A0A7S2P569 | 1-212 | NTAMWEVPPYVTALILFVLINLTGAMDGMQIALFAASKMPENQLHYYPTAQTNCELTFRGSNAQAFLIGRQICVTCCMFVIARITSP… |
| A0A7S1D2D9 | 79-303 | None |
| A0A6F9DIJ8 | 11-213 | None |
| K0SKM0 | 538-719 | None |
| A0A482SDR3 | 124-314 | None |
| A0A1E7EXC0 | 256-460 | None |
| B7GBI4 | 227-430 | None |
| A0A1Q1PWF8 | 613-839 | None |
| A0A7S2WHD4 | 2-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.