DPCstruct | MC17047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 54.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8AY02 | 13-131 | ATFLSCSRLPRRRCRNPRCRGLVKALEFDVQLQTEEAVRAGTGSTSGGADAAMWREIEALPWKGGQGGNNPDYECLRAELRRMAPPN… |
| A0A7J0GU61 | 1-87 | MKKAMEFDLQLQTEECLRSAAAAVKEIDGLPWKGGSEGNLDYECLRAELRKMAPPNGRAVLLFRARCGCPIAKLEGWGTKRCRRHKK |
| A0A7G2EEN9 | 58-170 | None |
| A0A7J7LYL1 | 1-71 | None |
| A0A7J0EEK8 | 63-148 | None |
| A0A4S4EWI2 | 395-504 | None |
| A0A7J9HTF0 | 57-154 | None |
| A0A368QHA6 | 227-327 | None |
| A0A1D6N8X2 | 110-216 | None |
| A0A2U1PR06 | 16-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.