DPCstruct | MC17046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 168 ± 18 aa |
| Standard deviation of domain lengths | 17.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 57.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446LXV7 | 101-253 | ERVSQETADGMGANCMHGRLNCGADCVWQASLVVSFGVWCIRWVLDQSLAESRPELWGKYTYVLNRLQGILDPAFCKPRKPVSGCSC… |
| B8AQ12 | 1-143 | MSLLPKCGDDCVWQAPLIVSFGVWCIRQILNLCLVESRPELWGKYTYVLNRLQGILDPAFSKPRKPMKGCVCLQKVAKPISGTFTTA… |
| A0A0P0X2N3 | 431-599 | None |
| A0A1Z5RNP0 | 504-639 | None |
| A0A0A8YW87 | 46-203 | None |
| A0A059A112 | 1086-1270 | None |
| A0A5N6Q5C9 | 951-1113 | None |
| A0A5P1F1X4 | 506-657 | None |
| A0A6G1BQX2 | 68-240 | None |
| A0A7S5GBN6 | 792-983 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.