DPCstruct | MC17045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 385 ± 84 aa |
| Standard deviation of domain lengths | 84.28 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7Z2Z1 | 9-327 | GRGWDRGSLYYGHRHARRLPKEAQPPFYKKVFAFIFGPEEPRPTQVQKDRGFLRLIRARKGVLTTAELVEHTALTLDDAREEMGRLT… |
| B8AJ12 | 12-396 | TIGDVSEEGEVLYVFPKDYRAKLAGKSFRMKVEPLIDKTKEVGAYLVRVSFGTALIASIVLVYTTIIAIISSSSDEDNRGRRRRSYD… |
| A0A388KS96 | 316-764 | None |
| A0A7S2HYV7 | 3-279 | None |
| A0A7S2N0H0 | 1-327 | None |
| A0A086CHV3 | 47-415 | None |
| A0A7S1D9D0 | 89-382 | None |
| A0A812I2X9 | 61-492 | None |
| A0A2E5HNR3 | 15-482 | None |
| A0A287U353 | 18-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.