DPCstruct | MC17044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7GWQ5 | 5-71 | ITVRTVQAKITANLNKSDTRTFIPFGQGDPSAFFRTTLVAEAAIVDSLCSANFNGDAPAAGIEPARR |
| B8AFY1 | 1-85 | MEAARSQSIRALVYRVYACLDRGDARSVAPLGHGDPAAFACFRAAPAATGAVVAAAASGAHNSYAPAAGIAEACRYIVFLIRLLR |
| A0A452XUY1 | 61-152 | None |
| A0A0K9R374 | 14-113 | None |
| A0A7J7H7S8 | 1-95 | None |
| A0A6L2N8B2 | 4-92 | None |
| A0A6A2YNL2 | 16-105 | None |
| A0A445C0K2 | 2-87 | None |
| A0A103Y858 | 1-93 | None |
| A0A0P0VI20 | 18-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.