DPCstruct | MC17042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 11.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9YPW7 | 59-165 | DGDASVVAIYVYDINNSANQLEPRQKEFLLAGNNNRVQQVYGSSIDQNIFNGFGTELLSEALGINTVAAKRLQSQNDQRGEIVHVKN… |
| A0A7N1A829 | 204-318 | DTSNDANQLDQSIRKFFLAGSSQSQQGRGQRGRQEGPRGPWKGRGEQSENWQSIFSGLDEELLSDVFNVNQEVIRSLRGQKEQRGSI… |
| A0A4Y7J130 | 65-173 | None |
| A0A5J5BNU5 | 574-670 | None |
| A0A7J6EI91 | 604-727 | None |
| A0A1P8B543 | 214-318 | None |
| A0A199VIM5 | 60-194 | None |
| A0A7N0V5M8 | 58-188 | None |
| A0A835IEY5 | 64-194 | None |
| A0A0E0NCE5 | 364-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.