DPCstruct | MC17040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 117 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R4U3C3 | 2-112 | LPKEQRKDLMTLGVIAAPSIWPNDPKHVTAQEIKNALKNNVQTAIEQIQPKAKLNVDYDFTVSRDDHGAIIDTLDFTSSIAANRTVY… |
| A0A433ETV0 | 1-121 | MTAAKNNLNKTFRVPIDYVIPSASKINISGINKLDNPTIHVADPTQTTAEQLKPQFKNVVLKAVKTVNSSLTEIDFDYFIESKGEDL… |
| A0A0H3XL53 | 208-316 | None |
| A0A3S0T708 | 85-200 | None |
| A0A3S0RDL0 | 162-285 | None |
| A0A2P6FC82 | 107-222 | None |
| A0A2P6FAC7 | 158-274 | None |
| A0A2P6F8Q9 | 48-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.