DPCstruct | MC1704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 430 ± 116 aa |
| Standard deviation of domain lengths | 116.35 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 77.33 |
| Assigned Pfam label(s) | CL0125- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1QSE3 | 189-497 | LFNPWNSEDEVYMDKEEDRQEYVMNEVGTIYNGVHNNITTRSWNFGQFEEGVLDACLTVMDAGNVPLLFRGNATEVVRQASALMNSQ… |
| A0A7R9EWQ8 | 24-538 | MEDKHLLEEYVVNDVGKIWVGPYGTSRGREWVFGQFDDCVLPACMVMLDRAAGAGTLKRSDPVAVTRAISRIVNSNDEDVSVAGVLH… |
| A0A6A4JYQ3 | 400-1006 | None |
| H9GPW7 | 38-531 | None |
| A0A0C2MKW2 | 20-381 | None |
| A0A0C2MGP9 | 78-626 | None |
| A0A5J5CFU0 | 3-393 | None |
| A0A834Y4R2 | 2-223 | None |
| A0A1I8F7F4 | 362-877 | None |
| A0A665SXR5 | 697-1148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.