DPCstruct | MC17039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 18.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A260A7U4 | 30-117 | SILFGVELGDGTKLAIDRRAPRGVVLEVGSSNGNLGSLHGTIFLGPVPPSGPVRIVTAIPRLGVPEATVTIDGNQIIETSEQVERLWT |
| A0A0A0JFE0 | 5-119 | PRVGLLLGDGTRLGAGDPGTSPDVAPDLPGDGGPPLYVQNGGGAGELRVQQSWWVSPVPEGDAELVLEWEAVGVPETFVPLDLASIR… |
| A0A2K8PCD9 | 83-223 | None |
| A0A221R665 | 3-111 | None |
| A0A535Z751 | 18-145 | None |
| A0A7W7C9Y5 | 88-199 | None |
| A0A1Q8AFX4 | 12-127 | None |
| A0A260UF86 | 38-180 | None |
| A0A2S6IC53 | 93-229 | None |
| A0A1G7WYA6 | 140-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.