DPCstruct | MC17035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Standard deviation of domain lengths | 26.65 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3MN12 | 12-170 | PLRPLPNLIFASRWLQLPLYLGLIAAQAVYVVHFLLELLHLIEAAAGSQAALQQLISSIGYKSTVPVTALNETIIMLVVLALIDVVM… |
| A0A286GXT5 | 7-197 | CLPRRVVPKSAPTVTYHFRGIIGVEHKIENGLFASRWLLFPFYVGLVLGIAALMLKFGQELLHLLPHIFDMTEQQVVLMVLALVDMT… |
| A0A1I4QZJ5 | 1-112 | None |
| D7DTR5 | 73-242 | None |
| A9RFF8 | 2-181 | None |
| A0A2M7L875 | 1-185 | None |
| A0A2Z5K265 | 5-162 | None |
| A0A0E3QE60 | 36-216 | None |
| E8UBQ9 | 1-170 | None |
| A0A840AD47 | 5-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.