DPCstruct | MC17031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 206 ± 28 aa |
| Standard deviation of domain lengths | 27.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2DPE6 | 20-212 | MHYVRAQCEGADKALGMALSLTWILAPNVHGLYFKDLKQTLKKEQCDQALMITANVPSAKKIIVHGPDSGMGGIPSQFPVHEDTQFQ… |
| A0A821CUD4 | 59-240 | FNYVLGLLLSMVRSPLDGSQELIANGLALLWQIIPYLHGLVLKDLKQILRKEQAEMLILVTGNIPSTKKVIIHGPDVSQIPTQAIIS… |
| A0A182EJT9 | 2-233 | None |
| A0A0B1S7S3 | 2-192 | None |
| H3A7U3 | 19-258 | None |
| A0A177B7Z4 | 242-385 | None |
| A0A131ZU79 | 196-379 | None |
| A0A444SIK5 | 320-553 | None |
| A0A182EDI4 | 2-233 | None |
| A0A7J7KL92 | 178-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.