DPCstruct | MC17030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 192 ± 21 aa |
| Standard deviation of domain lengths | 20.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2D419 | 6-198 | DFVWVYDVKPTRQAMENPENTLAMSRSCGIRIRAHQQEEPIYGIVLSITKRRDQVTAFRAAFEGAPEAVTVTQSICDFPLSDMQEDD… |
| A0A183GVE3 | 392-563 | MDTRHPYFFRVHEFILVTLPSTNEIVLGLVLEVPRRGARNDRVNNFRIALEGCPEAISIAPKICEFDITETRENQLLLAETRVNVST… |
| A0A368GEN4 | 152-359 | None |
| A0A368GG02 | 93-280 | None |
| A0A368FPB7 | 1-179 | None |
| A0A183FJ58 | 2-191 | None |
| A0A183FJ00 | 829-998 | None |
| A0A183FV80 | 168-377 | None |
| A0A368G181 | 1-203 | None |
| A0A0N4W373 | 55-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.