DPCstruct | MC1703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.15 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0220- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8E981 | 15-100 | LRERWLGSVFDEADIRKCGCLSEKETVQLVKRLNPRTLLCRVEHEVKEASVLNRDESQRGKITRSQFVEIYKAVATRSEIYFLMVQ |
| A0A3P7DPL6 | 210-295 | LRERWLGSVFDEADIRKCGCLSEKETVQLVKRLNPRTLLCRVEHEVKEASVLNRDESQRGKITRSQFVEIYKAVATRSEIYFLMVQ |
| A0A1I9GDR3 | 31-107 | None |
| A0A183EGW0 | 184-277 | None |
| A0A183QGC5 | 8-91 | None |
| A0A164RNT6 | 64-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.